PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_011222-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 456aa    MW: 51198.7 Da    PI: 5.3825
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_011222-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61e-16129175148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd ll+++vkq+G + W+ Ia+++   R +kqc++rw+++l
    NNU_011222-RA 129 KGQWTDEEDRLLIRLVKQYGVKKWAHIAQKLV-SRAGKQCRERWHNHL 175
                      799*****************************.*************97 PP

2Myb_DNA-binding56.27.8e-18181223145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W++eE+ ll++a+++ G++ W+ Ia++++ gRt++ +k++w+
    NNU_011222-RA 181 KDAWSEEEERLLIEAHEKIGNK-WAEIAKRIP-GRTENAIKNHWN 223
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.87124179IPR017930Myb domain
SuperFamilySSF466896.97E-31126222IPR009057Homeodomain-like
SMARTSM007174.3E-17128177IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-26130183IPR009057Homeodomain-like
CDDcd001672.72E-15132175No hitNo description
PfamPF139211.0E-19132192No hitNo description
PROSITE profilePS5129421.415180230IPR017930Myb domain
SMARTSM007176.5E-17180228IPR001005SANT/Myb domain
CDDcd001673.65E-13183226No hitNo description
Gene3DG3DSA:1.10.10.603.4E-21184228IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MKQNLHLFRL STTPLTAIER FLWSPSDLSQ KPTELNVTEG ETLVSSDGFV DLSTTSGATD  60
GYSTGASLPN LQNMSFVDGL FVDGDSFNWT SENRNHEKLG VIEKVTLGEK EAVSLGKRTK  120
GGSSANLIKG QWTDEEDRLL IRLVKQYGVK KWAHIAQKLV SRAGKQCRER WHNHLRPDIK  180
KDAWSEEEER LLIEAHEKIG NKWAEIAKRI PGRTENAIKN HWNATKRRQN SKRRLKKAAI  240
QGGKSKPSLL QEYIEKILKD NSTNKTPTTP TNTKATDSTL PTTPSKQLSV TLPETSESTL  300
TEDFLTLIVQ TYDEELHFIT KFFENIYEQS SDGTIVESTN EDTGHGWDFQ NPLPFDSQTS  360
IEADECSGYS STTPITNAYV DNISGEDTKT SHLYSDLYLS YLLNGATSSS SMSQNYYFEN  420
PDIDLLRNQS SSDGKKEMDL IEMVSSQFSQ SSSSSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-441272292104C-Myb DNA-Binding Domain
1mse_C2e-441272292104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00567DAPTransfer from AT5G58850Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262919.10.0PREDICTED: transcription factor MYB29
TrEMBLB9SHZ41e-117B9SHZ4_RICCO; Myb119, putative
STRINGPOPTR_0009s04870.11e-105(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.16e-58myb domain protein 119